SCOP 1.67: Domain d1o7ac2: 1o7a C:54-199

Lineage for d1o7ac2 (1o7a C:54-199)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (3 proteins)
   family GH20

6. Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89993] (4 PDB entries)

8. Domain d1o7ac2: 1o7a C:54-199 [92613]
   Other proteins in same PDB: d1o7aa1, d1o7ab1, d1o7ac1, d1o7ad1, d1o7ae1, d1o7af1

Details for d1o7ac2

PDB Entry: 1o7a, 2.25 Å

PDB Description: human beta-hexosaminidase b

SCOP Domain Sequences for d1o7ac2:

Sequence, based on SEQRES records:

>d1o7ac2 d.92.2.1 (C:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens)}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh
epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle
tfsqlvyqdsygtftinestiidspr

Sequence, based on observed residues (ATOM records):

>d1o7ac2 d.92.2.1 (C:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens)}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
tinestiidspr

Timeline for d1o7ac2:

• d1o7ac2 is new in SCOP 1.67
  
• d1o7ac2 appears in SCOP 1.69
  
• d1o7ac2 appears in the current release, SCOPe 2.08