Lineage for d1o7ab1 (1o7a B:200-554)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083407Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 protein domains)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 2083424Protein beta-hexosaminidase B [89486] (1 species)
  7. 2083425Species Human (Homo sapiens) [TaxId:9606] [89487] (6 PDB entries)
  8. 2083429Domain d1o7ab1: 1o7a B:200-554 [92610]
    Other proteins in same PDB: d1o7aa2, d1o7ab2, d1o7ac2, d1o7ad2, d1o7ae2, d1o7af2
    complexed with edo, gdl, nag

Details for d1o7ab1

PDB Entry: 1o7a (more details), 2.25 Å

PDB Description: Human beta-Hexosaminidase B
PDB Compounds: (B:) beta-hexosaminidase beta chain

SCOPe Domain Sequences for d1o7ab1:

Sequence, based on SEQRES records: (download)

>d1o7ab1 c.1.8.6 (B:200-554) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysrqnkldsf
gpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtd
fkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtas
gfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnlt
prlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycnhe

Sequence, based on observed residues (ATOM records): (download)

>d1o7ab1 c.1.8.6 (B:200-554) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcyskldsfgpi
nptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtdfkk
lesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtasgfp
vilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnltprl
wprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycnhe

SCOPe Domain Coordinates for d1o7ab1:

Click to download the PDB-style file with coordinates for d1o7ab1.
(The format of our PDB-style files is described here.)

Timeline for d1o7ab1: