SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1o7aa1 (1o7a A:200-554)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083407Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 protein domains)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 2083424Protein beta-hexosaminidase B [89486] (1 species)
  7. 2083425Species Human (Homo sapiens) [TaxId:9606] [89487] (6 PDB entries)
  8. 2083428Domain d1o7aa1: 1o7a A:200-554 [92608]
    Other proteins in same PDB: d1o7aa2, d1o7ab2, d1o7ac2, d1o7ad2, d1o7ae2, d1o7af2
    complexed with edo, gdl, nag

Details for d1o7aa1

PDB Entry: 1o7a (more details), 2.25 Å

PDB Description: Human beta-Hexosaminidase B
PDB Compounds: (A:) beta-hexosaminidase beta chain

SCOPe Domain Sequences for d1o7aa1:

Sequence, based on SEQRES records: (download)

>d1o7aa1 c.1.8.6 (A:200-554) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysrqnkldsf
gpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtd
fkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtas
gfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnlt
prlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycnhe

Sequence, based on observed residues (ATOM records): (download)

>d1o7aa1 c.1.8.6 (A:200-554) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcyskldsfgpi
nptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtdfkk
lesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtasgfp
vilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnltprl
wprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycnhe

SCOPe Domain Coordinates for d1o7aa1:

Click to download the PDB-style file with coordinates for d1o7aa1.
(The format of our PDB-style files is described here.)

Timeline for d1o7aa1: