![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.97: Cytolysin/lectin [63723] (1 superfamily) sandwich, 10 strands in 2 sheets; |
![]() | Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) ![]() some topological similarity to osmotin |
![]() | Family b.97.1.1: Anemone pore-forming cytolysin [63725] (3 proteins) Pfam PF06369 |
![]() | Protein Sticholysin II [89268] (1 species) |
![]() | Species Carribean sea anemone (Stoichactis helianthus) [TaxId:6123] [89269] (6 PDB entries) |
![]() | Domain d1o71b_: 1o71 B: [92599] complexed with gol |
PDB Entry: 1o71 (more details), 2.26 Å
SCOPe Domain Sequences for d1o71b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o71b_ b.97.1.1 (B:) Sticholysin II {Carribean sea anemone (Stoichactis helianthus) [TaxId: 6123]} alagtiiagasltfqvldkvleelgkvsrkiavgidnesggtwtalnayfrsgttdvilp efvpntkallysgrkdtgpvatgavaafayymssgntlgvmfsvpfdynwysnwwdvkiy sgkrradqgmyedlyygnpyrgdngwheknlgyglrmkgimtsageakmqikisr
Timeline for d1o71b_: