Lineage for d1o6uc2 (1o6u C:275-396)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 473072Fold b.132: Supernatant protein factor (SPF), C-terminal domain [101575] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll; similarity to the Nucleoplasmin-like/VP fold
  4. 473073Superfamily b.132.1: Supernatant protein factor (SPF), C-terminal domain [101576] (1 family) (S)
  5. 473074Family b.132.1.1: Supernatant protein factor (SPF), C-terminal domain [101577] (1 protein)
  6. 473075Protein Supernatant protein factor (SPF), C-terminal domain [101578] (1 species)
  7. 473076Species Human (Homo sapiens) [TaxId:9606] [101579] (2 PDB entries)
  8. 473081Domain d1o6uc2: 1o6u C:275-396 [92593]
    Other proteins in same PDB: d1o6ua1, d1o6ua3, d1o6uc1, d1o6uc3, d1o6ue1, d1o6ue3

Details for d1o6uc2

PDB Entry: 1o6u (more details), 2.05 Å

PDB Description: the crystal structure of human supernatant protein factor

SCOP Domain Sequences for d1o6uc2:

Sequence, based on SEQRES records: (download)

>d1o6uc2 b.132.1.1 (C:275-396) Supernatant protein factor (SPF), C-terminal domain {Human (Homo sapiens)}
kqqyehsvqisrgsshqveyeilfpgcvlrwqfmsdgadvgfgiflktkmgerqragemt
evlpnqrynshlvpedgtltcsdpgiyvlrfdntysfihakkvnftvevllpdkaseekm
kq

Sequence, based on observed residues (ATOM records): (download)

>d1o6uc2 b.132.1.1 (C:275-396) Supernatant protein factor (SPF), C-terminal domain {Human (Homo sapiens)}
kqqyehsvqisrgsshqveyeilfpgcvlrwqfmsdgadvgfgiflktemtevlpnqryn
shlvpedgtltcsdpgiyvlrfdntysfihakkvnftvevllpdkaseekmkq

SCOP Domain Coordinates for d1o6uc2:

Click to download the PDB-style file with coordinates for d1o6uc2.
(The format of our PDB-style files is described here.)

Timeline for d1o6uc2: