Lineage for d1o6ua1 (1o6u A:1-75)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1723911Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1724124Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) (S)
  5. 1724125Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins)
  6. 1724135Protein Supernatant protein factor (SPF), N-terminal domain [101071] (1 species)
    Sec14-like protein 2; contains extra C-terminal beta-sandwich domain
  7. 1724136Species Human (Homo sapiens) [TaxId:9606] [101072] (2 PDB entries)
    Uniprot O76054
  8. 1724140Domain d1o6ua1: 1o6u A:1-75 [92589]
    Other proteins in same PDB: d1o6ua2, d1o6ua3, d1o6uc2, d1o6uc3, d1o6ue2, d1o6ue3
    complexed with plm

Details for d1o6ua1

PDB Entry: 1o6u (more details), 2.05 Å

PDB Description: the crystal structure of human supernatant protein factor
PDB Compounds: (A:) sec14-like protein 2

SCOPe Domain Sequences for d1o6ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6ua1 a.5.3.1 (A:1-75) Supernatant protein factor (SPF), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
msgrvgdlsprqkealakfrenvqdvlpalpnpddyfllrwlrarsfdlqkseamlrkhv
efrkqkdidniiswq

SCOPe Domain Coordinates for d1o6ua1:

Click to download the PDB-style file with coordinates for d1o6ua1.
(The format of our PDB-style files is described here.)

Timeline for d1o6ua1: