SCOP 1.71: Domain d1o6ua1: 1o6u A:1-75

Lineage for d1o6ua1 (1o6u A:1-75)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (1 family)

5. Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins)

6. Protein Supernatant protein factor (SPF), N-terminal domain [101071] (1 species)
   Sec14-like protein 2; contains extra C-terminal beta-sandwich domain

7. Species Human (Homo sapiens) [TaxId:9606] [101072] (2 PDB entries)

8. Domain d1o6ua1: 1o6u A:1-75 [92589]
   Other proteins in same PDB: d1o6ua2, d1o6ua3, d1o6uc2, d1o6uc3, d1o6ue2, d1o6ue3

Details for d1o6ua1

PDB Entry: 1o6u, 2.05 Å

PDB Description: the crystal structure of human supernatant protein factor

SCOP Domain Sequences for d1o6ua1:

Sequence; same for both SEQRES and ATOM records:

>d1o6ua1 a.5.3.1 (A:1-75) Supernatant protein factor (SPF), N-terminal domain {Human (Homo sapiens)}
msgrvgdlsprqkealakfrenvqdvlpalpnpddyfllrwlrarsfdlqkseamlrkhv
efrkqkdidniiswq

Timeline for d1o6ua1:

• d1o6ua1 first appeared in SCOP 1.67
  
• d1o6ua1 appears in SCOP 1.69
  
• d1o6ua1 appears in SCOP 1.73
  
• d1o6ua1 appears in the current release, SCOPe 2.08