Lineage for d1o6rc2 (1o6r C:37-307)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541757Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 541951Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 541977Family a.102.4.2: Terpene synthases [48243] (2 proteins)
    consists of two toroid domains: one of six and one of five hairpins
  6. 541984Protein Squalene-hopene cyclase [48244] (1 species)
  7. 541985Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)
  8. 542009Domain d1o6rc2: 1o6r C:37-307 [92588]
    complexed with c8e, r19

Details for d1o6rc2

PDB Entry: 1o6r (more details), 2.7 Å

PDB Description: structures of human oxidosqualene cyclase inhibitors bound to an homologous enzyme

SCOP Domain Sequences for d1o6rc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6rc2 a.102.4.2 (C:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius}
lsnvtmeaeyvllchildrvdrdrmekirryllheqredgtwalypggppdldttieayv
alkyigmsrdeepmqkalrfiqsqggiessrvftrmwlalvgeypwekvpmvppeimflg
krmplniyefgswaratvvalsivmsrqpvfplperarvpelyetdvpprrrgakggggw
ifdaldralhgyqklsvhpfrraaeiraldwllerqagdgswggiqppwfyalialkild
mtqhpafikgweglelygveldyggwmfqas

SCOP Domain Coordinates for d1o6rc2:

Click to download the PDB-style file with coordinates for d1o6rc2.
(The format of our PDB-style files is described here.)

Timeline for d1o6rc2: