SCOP 1.73: Domain d1o6qc1: 1o6q C:10-36,C:308-629

Lineage for d1o6qc1 (1o6q C:10-36,C:308-629)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.2: Terpene synthases [48243] (2 proteins)
   consists of two toroid domains: one of six and one of five hairpins

6. Protein Squalene-hopene cyclase [48244] (1 species)

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)

8. Domain d1o6qc1: 1o6q C:10-36,C:308-629 [92581]

Details for d1o6qc1

PDB Entry: 1o6q, 2.8 Å

PDB Description: structures of human oxidosqualene cyclase inhibitors bound to an homologous enzyme

PDB Compounds: (C:) squalene--hopene cyclase

SCOP Domain Sequences for d1o6qc1:

Sequence; same for both SEQRES and ATOM records:

>d1o6qc1 a.102.4.2 (C:10-36,C:308-629) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
ayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkagew
lldrqitvpgdwavkrpnlkpggfafqfdnvyypdvddtavvvwalntlrlpderrrrda
mtkgfrwivgmqssnggwgaydvdntsdlpnhipfcdfgevtdppsedvtahvlecfgsf
gyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiqka
ldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrgvq
ylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqaie

Timeline for d1o6qc1:

• d1o6qc1 first appeared in SCOP 1.67
  
• d1o6qc1 appears in SCOP 1.71
  
• d1o6qc1 appears in SCOP 1.75
  
• d1o6qc1 appears in the current release, SCOPe 2.08