SCOP 1.67: Domain d1o6qb2: 1o6q B:37-307

Lineage for d1o6qb2 (1o6q B:37-307)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.2: Terpene synthases [48243] (1 protein)
   consists of two toroid domains: one of six and one of five hairpins

6. Protein Squalene-hopene cyclase [48244] (1 species)

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)

8. Domain d1o6qb2: 1o6q B:37-307 [92580]

Details for d1o6qb2

PDB Entry: 1o6q, 2.8 Å

PDB Description: structures of human oxidosqualene cyclase inhibitors bound to an homologous enzyme

SCOP Domain Sequences for d1o6qb2:

Sequence; same for both SEQRES and ATOM records:

>d1o6qb2 a.102.4.2 (B:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius}
lsnvtmeaeyvllchildrvdrdrmekirryllheqredgtwalypggppdldttieayv
alkyigmsrdeepmqkalrfiqsqggiessrvftrmwlalvgeypwekvpmvppeimflg
krmplniyefgswaratvvalsivmsrqpvfplperarvpelyetdvpprrrgakggggw
ifdaldralhgyqklsvhpfrraaeiraldwllerqagdgswggiqppwfyalialkild
mtqhpafikgweglelygveldyggwmfqas

Timeline for d1o6qb2:

• d1o6qb2 is new in SCOP 1.67
  
• d1o6qb2 appears in SCOP 1.69
  
• d1o6qb2 appears in the current release, SCOPe 2.08