Lineage for d1o6oc_ (1o6o C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 921850Superfamily a.118.1: ARM repeat [48371] (24 families) (S)
  5. 921851Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 921892Protein Importin beta [48378] (3 species)
  7. 921895Species Human (Homo sapiens) [TaxId:9606] [48379] (10 PDB entries)
  8. 921907Domain d1o6oc_: 1o6o C: [92576]
    bound to five fxfg repeats from yeast nsp1p, chains D, E and F

Details for d1o6oc_

PDB Entry: 1o6o (more details), 2.8 Å

PDB Description: importin beta aa1-442 bound to five fxfg repeats from yeast nsp1p. second crystal form
PDB Compounds: (C:) importin beta-1 subunit

SCOPe Domain Sequences for d1o6oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6oc_ a.118.1.1 (C:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
elitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglqi
knsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacaei
pvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqgm
rkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqnl
vkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieaseaa
eqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcced
divphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdps
vvvrdtaawtvgricellpe

SCOPe Domain Coordinates for d1o6oc_:

Click to download the PDB-style file with coordinates for d1o6oc_.
(The format of our PDB-style files is described here.)

Timeline for d1o6oc_: