Lineage for d1o6oa_ (1o6o A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1278586Superfamily a.118.1: ARM repeat [48371] (24 families) (S)
  5. 1278587Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 1278640Protein Importin beta [48378] (3 species)
  7. 1278643Species Human (Homo sapiens) [TaxId:9606] [48379] (10 PDB entries)
  8. 1278653Domain d1o6oa_: 1o6o A: [92574]
    bound to five fxfg repeats from yeast nsp1p, chains D, E and F

Details for d1o6oa_

PDB Entry: 1o6o (more details), 2.8 Å

PDB Description: importin beta aa1-442 bound to five fxfg repeats from yeast nsp1p. second crystal form
PDB Compounds: (A:) importin beta-1 subunit

SCOPe Domain Sequences for d1o6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6oa_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
elitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglqi
knsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacaei
pvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqgm
rkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqnl
vkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieaseaa
eqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcced
divphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdps
vvvrdtaawtvgricellpe

SCOPe Domain Coordinates for d1o6oa_:

Click to download the PDB-style file with coordinates for d1o6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1o6oa_: