Lineage for d1o6oa_ (1o6o A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359729Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 359730Superfamily a.118.1: ARM repeat [48371] (14 families) (S)
  5. 359731Family a.118.1.1: Armadillo repeat [48372] (5 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 359762Protein Importin beta [48378] (2 species)
  7. 359763Species Human (Homo sapiens) [TaxId:9606] [48379] (8 PDB entries)
  8. 359769Domain d1o6oa_: 1o6o A: [92574]

Details for d1o6oa_

PDB Entry: 1o6o (more details), 2.8 Å

PDB Description: importin beta aa1-442 bound to five fxfg repeats from yeast nsp1p. second crystal form

SCOP Domain Sequences for d1o6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6oa_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens)}
elitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglqi
knsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacaei
pvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqgm
rkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqnl
vkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieaseaa
eqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcced
divphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdps
vvvrdtaawtvgricellpe

SCOP Domain Coordinates for d1o6oa_:

Click to download the PDB-style file with coordinates for d1o6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1o6oa_: