SCOPe 2.08: Domain d1o6da1: 1o6d A:2-147

Lineage for d1o6da1 (1o6d A:2-147)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.3: YbeA-like [82371] (5 proteins)
   Pfam PF02590

6. Protein Hypothetical protein TM0844 [102274] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [102275] (1 PDB entry)

8. Domain d1o6da1: 1o6d A:2-147 [92567]
   Other proteins in same PDB: d1o6da2
   structural genomics

Details for d1o6da1

PDB Entry: 1o6d, 1.66 Å

PDB Description: crystal structure of a hypothetical protein

PDB Compounds: (A:) Hypothetical UPF0247 protein TM0844

SCOPe Domain Sequences for d1o6da1:

Sequence; same for both SEQRES and ATOM records:

>d1o6da1 c.116.1.3 (A:2-147) Hypothetical protein TM0844 {Thermotoga maritima [TaxId: 2336]}
rvriavigkldgfikegikhyekflrrfckpevleikrvhrgsieeivrketedltnril
pgsfvmvmdkrgeevsseefadflkdlemkgkditiliggpyglneeifakahrvfslsk
mtfthgmtvlivleqifrafkiihge

Timeline for d1o6da1:

• d1o6da1 first appeared in SCOP 1.67, called d1o6da_
  
• d1o6da1 appears in SCOPe 2.07