Lineage for d1o6cb1 (1o6c B:2-379)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142080Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (2 protein domains)
    automatically mapped to Pfam PF02350
  6. 2142081Protein UDP-N-acetylglucosamine 2-epimerase [53764] (3 species)
  7. 2142082Species Bacillus subtilis [TaxId:1423] [102678] (1 PDB entry)
  8. 2142084Domain d1o6cb1: 1o6c B:2-379 [92566]
    Other proteins in same PDB: d1o6cb2
    structural genomics

Details for d1o6cb1

PDB Entry: 1o6c (more details), 2.9 Å

PDB Description: crystal structure of udp-n-acetylglucosamine 2-epimerase
PDB Compounds: (B:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d1o6cb1:

Sequence, based on SEQRES records: (download)

>d1o6cb1 c.87.1.3 (B:2-379) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]}
kklkvmtvfgtrpeaikmaplvlelkkypeidsyvtvtaqhrqmldqvldafhikpdfdl
nimkerqtlaeitsnalvrldelfkdikpdivlvhgdttttfagslaafyhqiavghvea
glrtgnkyspfpeelnrqmtgaiadlhfaptgqakdnllkenkkadsifvtgntaidaln
ttvrdgyshpvldqvgedkmilltahrrenlgepmenmfkairrivgefedvqvvypvhl
npvvreaahkhfgdsdrvhlieplevidfhnfaakshfiltdsggvqeeapslgkpvlvl
rdtterpegveagtlklagtdeeniyqlakqlltdpdeykkmsqasnpygdgeasrrive
ellfhygyrkeqpdsftg

Sequence, based on observed residues (ATOM records): (download)

>d1o6cb1 c.87.1.3 (B:2-379) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]}
kklkvmtvfgtrpeaikmaplvlelkkypeidsyvtvtaqhrqmldqvldafhikpdfdl
nimkerqtlaeitsnalvrldelfkdikpdivlvhgdttttfagslaafyhqiavghvea
glrtgnkyspfpeelnrqmtgaiadlhfaptgqakdnllkenkkadsifvtgntaidaln
ttvrdgyshpvldqvgedkmilltapmenmfkairrivgefedvqvvypvhlnpvvreaa
hkhfgdsdrvhlieplevidfhnfaakshfiltdsggvqeeapslgkpvlvlrdtterpe
gveagtlklagtdeeniyqlakqlltdpdeykkmsqasnpygdgeasrriveellfhygy
rkeqpdsftg

SCOPe Domain Coordinates for d1o6cb1:

Click to download the PDB-style file with coordinates for d1o6cb1.
(The format of our PDB-style files is described here.)

Timeline for d1o6cb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o6cb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1o6ca_