![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
![]() | Protein Phosphopantetheine adenylyltransferase [52398] (7 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [102259] (1 PDB entry) |
![]() | Domain d1o6ba1: 1o6b A:2-161 [92564] Other proteins in same PDB: d1o6ba2 structural genomics complexed with adp, cl, mg, po4 |
PDB Entry: 1o6b (more details), 2.2 Å
SCOPe Domain Sequences for d1o6ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o6ba1 c.26.1.3 (A:2-161) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} asiavcpgsfdpvtyghldiikrgahifeqvyvcvlnnsskkplfsveercellrevtkd ipnitvetsqgllidyarrknakailrglravsdfeyemqgtsvnrvldesietffmman nqysflsssivkevarydgsvsefvppevelalqqkfrqg
Timeline for d1o6ba1: