Lineage for d1o6ba1 (1o6b A:2-161)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) Protein Phosphopantetheine adenylyltransferase [52398] (7 species) 
Species Bacillus subtilis [TaxId:1423] [102259] (1 PDB entry) 
Domain d1o6ba1: 1o6b A:2-161 [92564]
Other proteins in same PDB: d1o6ba2
structural genomics
complexed with adp, cl, mg, po4
Details for d1o6ba1
PDB Entry: 1o6b (more details), 2.2 Å
PDB Description: crystal structure of phosphopantetheine adenylyltransferase with adp
PDB Compounds: (A:) phosphopantetheine adenylyltransferaseSCOPe Domain Sequences for d1o6ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o6ba1 c.26.1.3 (A:2-161) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]}
asiavcpgsfdpvtyghldiikrgahifeqvyvcvlnnsskkplfsveercellrevtkd
ipnitvetsqgllidyarrknakailrglravsdfeyemqgtsvnrvldesietffmman
nqysflsssivkevarydgsvsefvppevelalqqkfrqg
SCOPe Domain Coordinates for d1o6ba1:
Click to download the PDB-style file with coordinates for d1o6ba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o6ba1:
- d1o6ba1 first appeared in SCOP 1.67, called d1o6ba_
- d1o6ba1 appears in SCOPe 2.07
View in 3D
