Lineage for d1o68e_ (1o68 E:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386143Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 386313Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (1 protein)
  6. 386314Protein Ketopantoate hydroxymethyltransferase PanB [89504] (3 species)
    dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme
  7. 386332Species Neisseria meningitidis [TaxId:487] [102100] (2 PDB entries)
  8. 386342Domain d1o68e_: 1o68 E: [92559]
    structural genomics
    complexed with kiv, na

Details for d1o68e_

PDB Entry: 1o68 (more details), 2.1 Å

PDB Description: crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase

SCOP Domain Sequences for d1o68e_:

Sequence, based on SEQRES records: (download)

>d1o68e_ c.1.12.8 (E:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis}
slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs
lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma
etteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlme
cvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvq
aavrayvaevkaktfpaaehi

Sequence, based on observed residues (ATOM records): (download)

>d1o68e_ c.1.12.8 (E:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis}
slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs
lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma
etteflqmrgipvcahigltpqsvfaaqallndakahddagaavvlmecvlaelakkvte
tvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvqaavrayvaevka
ktfpaaehi

SCOP Domain Coordinates for d1o68e_:

Click to download the PDB-style file with coordinates for d1o68e_.
(The format of our PDB-style files is described here.)

Timeline for d1o68e_: