Lineage for d1o68d_ (1o68 D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475982Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 476155Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (1 protein)
  6. 476156Protein Ketopantoate hydroxymethyltransferase PanB [89504] (3 species)
    dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme
  7. 476174Species Neisseria meningitidis [TaxId:487] [102100] (2 PDB entries)
  8. 476183Domain d1o68d_: 1o68 D: [92558]

Details for d1o68d_

PDB Entry: 1o68 (more details), 2.1 Å

PDB Description: crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase

SCOP Domain Sequences for d1o68d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o68d_ c.1.12.8 (D:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis}
slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs
lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma
etteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlme
cvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvq
aavrayvaevkaktfpaaehif

SCOP Domain Coordinates for d1o68d_:

Click to download the PDB-style file with coordinates for d1o68d_.
(The format of our PDB-style files is described here.)

Timeline for d1o68d_: