Lineage for d1o68d1 (1o68 D:2-261)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2838267Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (2 proteins)
    automatically mapped to Pfam PF02548
  6. 2838268Protein Ketopantoate hydroxymethyltransferase PanB [89504] (3 species)
    dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme
  7. 2838286Species Neisseria meningitidis [TaxId:487] [102100] (2 PDB entries)
  8. 2838295Domain d1o68d1: 1o68 D:2-261 [92558]
    Other proteins in same PDB: d1o68a2, d1o68b2, d1o68c2, d1o68d2, d1o68e2
    structural genomics
    complexed with kiv, na

Details for d1o68d1

PDB Entry: 1o68 (more details), 2.1 Å

PDB Description: crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase
PDB Compounds: (D:) 3-methyl-2-oxobutanoate hydroxymethyltransferase

SCOPe Domain Sequences for d1o68d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o68d1 c.1.12.8 (D:2-261) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]}
itvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvslr
dmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwmaet
teflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlmecv
laelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvqaa
vrayvaevkaktfpaaehif

SCOPe Domain Coordinates for d1o68d1:

Click to download the PDB-style file with coordinates for d1o68d1.
(The format of our PDB-style files is described here.)

Timeline for d1o68d1: