Lineage for d1o67c_ (1o67 C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378454Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 378455Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 378546Family b.58.1.2: MOSC (MOCO sulphurase C-terminal) domain [101844] (2 proteins)
    Pfam 03473
  6. 378547Protein Hypothetical protein YiiM [101847] (1 species)
  7. 378548Species Escherichia coli [TaxId:562] [101848] (2 PDB entries)
  8. 378554Domain d1o67c_: 1o67 C: [92554]
    structural genomics
    mutant

Details for d1o67c_

PDB Entry: 1o67 (more details), 2.54 Å

PDB Description: crystal structure of an hypothetical protein

SCOP Domain Sequences for d1o67c_:

Sequence, based on SEQRES records: (download)

>d1o67c_ b.58.1.2 (C:) Hypothetical protein YiiM {Escherichia coli}
lvereqmrypvdvytgkiqaypegkpsaiakiqvdgelmltelglegdeqaekkvhggpd
ralchyprehylywarefpeqaelfvapafgenlstdgltesnvymgdifrwgealiqvs
qprspcyklnyhfdisdiaqlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqea
aaiawhmpfdddqyhrllsaaglskswtrtmqkrrlsgkiedfsrrlwg

Sequence, based on observed residues (ATOM records): (download)

>d1o67c_ b.58.1.2 (C:) Hypothetical protein YiiM {Escherichia coli}
lvereqmrypvdvytgakiqvdgelmltelglegdeqagpdralchyprehylywarefp
eqaelfvapafgenlstdgltesnvymgdifrwgealiqvsqprspcyklnyhfdisdia
qlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqeaaaiawhmpfdddqyhrlls
aaglskswtrtmqkrrlsgkiedfsrrlwg

SCOP Domain Coordinates for d1o67c_:

Click to download the PDB-style file with coordinates for d1o67c_.
(The format of our PDB-style files is described here.)

Timeline for d1o67c_: