Lineage for d1o67b1 (1o67 B:4-234)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062352Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2062353Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2062495Family b.58.1.2: MOSC (MOCO sulphurase C-terminal) domain [101844] (2 protein domains)
    Pfam PF03473
  6. 2062496Protein Hypothetical protein YiiM [101847] (1 species)
  7. 2062497Species Escherichia coli [TaxId:562] [101848] (2 PDB entries)
  8. 2062502Domain d1o67b1: 1o67 B:4-234 [92553]
    Other proteins in same PDB: d1o67a2, d1o67b2
    structural genomics

Details for d1o67b1

PDB Entry: 1o67 (more details), 2.54 Å

PDB Description: crystal structure of an hypothetical protein
PDB Compounds: (B:) Hypothetical protein yiiM

SCOPe Domain Sequences for d1o67b1:

Sequence, based on SEQRES records: (download)

>d1o67b1 b.58.1.2 (B:4-234) Hypothetical protein YiiM {Escherichia coli [TaxId: 562]}
flvereqmrypvdvytgkiqaypegkpsaiakiqvdgelmltelglegdeqaekkvhggp
dralchyprehylywarefpeqaelfvapafgenlstdgltesnvymgdifrwgealiqv
sqprspcyklnyhfdisdiaqlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqe
aaaiawhmpfdddqyhrllsaaglskswtrtmqkrrlsgkiedfsrrlwgk

Sequence, based on observed residues (ATOM records): (download)

>d1o67b1 b.58.1.2 (B:4-234) Hypothetical protein YiiM {Escherichia coli [TaxId: 562]}
flvereqmrypvdvytgakiqvdgelmltelglegdevhggpdralchyprehylyware
fpeqaelfvapafgenlstdgltesnvymgdifrwgealiqvsqprspcyklnyhfdisd
iaqlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqeaaaiawhmpfdddqyhrl
lsaaglskswtrtmqkrrlsgkiedfsrrlwgk

SCOPe Domain Coordinates for d1o67b1:

Click to download the PDB-style file with coordinates for d1o67b1.
(The format of our PDB-style files is described here.)

Timeline for d1o67b1: