SCOPe 2.06: Domain d1o67a1: 1o67 A:4-234

Lineage for d1o67a1 (1o67 A:4-234)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.2: MOSC (MOCO sulphurase C-terminal) domain [101844] (2 proteins)
   Pfam PF03473

6. Protein Hypothetical protein YiiM [101847] (1 species)

7. Species Escherichia coli [TaxId:562] [101848] (2 PDB entries)

8. Domain d1o67a1: 1o67 A:4-234 [92552]
   Other proteins in same PDB: d1o67a2, d1o67b2
   structural genomics

Details for d1o67a1

PDB Entry: 1o67, 2.54 Å

PDB Description: crystal structure of an hypothetical protein

PDB Compounds: (A:) Hypothetical protein yiiM

SCOPe Domain Sequences for d1o67a1:

Sequence, based on SEQRES records:

>d1o67a1 b.58.1.2 (A:4-234) Hypothetical protein YiiM {Escherichia coli [TaxId: 562]}
flvereqmrypvdvytgkiqaypegkpsaiakiqvdgelmltelglegdeqaekkvhggp
dralchyprehylywarefpeqaelfvapafgenlstdgltesnvymgdifrwgealiqv
sqprspcyklnyhfdisdiaqlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqe
aaaiawhmpfdddqyhrllsaaglskswtrtmqkrrlsgkiedfsrrlwgk

Sequence, based on observed residues (ATOM records):

>d1o67a1 b.58.1.2 (A:4-234) Hypothetical protein YiiM {Escherichia coli [TaxId: 562]}
flvereqmrypvdvytgkakiqvdgelmltelglegdeggpdralchyprehylywaref
peqaelfvapafgenlstdgltesnvymgdifrwgealiqvsqprspcyklnyhfdisdi
aqlmqntgkvgwlysviapgkvsadaplelvsrvsdvtvqeaaaiawhmpfdddqyhrll
saaglskswtrtmqkrrlsgkiedfsrrlwgk

Timeline for d1o67a1:

• d1o67a1 first appeared in SCOP 1.67, called d1o67a_
  
• d1o67a1 was called d1o67a_ in SCOPe 2.05
  
• d1o67a1 appears in SCOPe 2.07
  
• d1o67a1 appears in the current release, SCOPe 2.08