Lineage for d1o66e1 (1o66 E:2-257)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100061Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2100353Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (2 proteins)
    automatically mapped to Pfam PF02548
  6. 2100354Protein Ketopantoate hydroxymethyltransferase PanB [89504] (3 species)
    dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme
  7. 2100372Species Neisseria meningitidis [TaxId:487] [102100] (2 PDB entries)
  8. 2100377Domain d1o66e1: 1o66 E:2-257 [92551]
    Other proteins in same PDB: d1o66a2, d1o66b2, d1o66c2, d1o66d2, d1o66e2
    structural genomics
    complexed with gol

Details for d1o66e1

PDB Entry: 1o66 (more details), 1.75 Å

PDB Description: crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase
PDB Compounds: (E:) 3-methyl-2-oxobutanoate hydroxymethyltransferase

SCOPe Domain Sequences for d1o66e1:

Sequence, based on SEQRES records: (download)

>d1o66e1 c.1.12.8 (E:2-257) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]}
itvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvslr
dmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwmaet
teflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlmecv
laelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvqaa
vrayvaevkaktfpaa

Sequence, based on observed residues (ATOM records): (download)

>d1o66e1 c.1.12.8 (E:2-257) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]}
itvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvslr
dmcyhtecvarganamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwmaett
eflqmrgipvcahigaqallndakahddagaavvlmecvlaelakkvtetvscptigiga
gadcdgqvlvmhdmlgifpgktakfvknfmqghdsvqaavrayvaevkaktfpaa

SCOPe Domain Coordinates for d1o66e1:

Click to download the PDB-style file with coordinates for d1o66e1.
(The format of our PDB-style files is described here.)

Timeline for d1o66e1: