Lineage for d1o62b_ (1o62 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131807Protein Aminotransferase homolog WlaK (PglE, Cj1121c) [102603] (1 species)
  7. 2131808Species Campylobacter jejuni [TaxId:197] [102604] (3 PDB entries)
  8. 2131814Domain d1o62b_: 1o62 B: [92539]
    structural genomics
    complexed with act, bme

Details for d1o62b_

PDB Entry: 1o62 (more details), 2.1 Å

PDB Description: crystal structure of the apo form of a plp-dependent enzyme
PDB Compounds: (B:) aminotransferase

SCOPe Domain Sequences for d1o62b_:

Sequence, based on SEQRES records: (download)

>d1o62b_ c.67.1.4 (B:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]}
gnelkyieevfksnyiaplgefvnrfeqsvkdysksenalalnsataalhlalrvagvkq
ddivlassftfiasvapicylkakpvfidcdetynidvdllklaikecekkpkalilthl
ygnaakmdeiveickendivliedaaealgsfyknkalgtfgefgvysyngnkiittsgg
gmligknkekiekarfystqarenclhyehldygynyrlsnvlgaigvaqmevleqrvlk
kreiyewykeflgeyfsfldelensrsnrwlstalinfdknelnacqkdinisqknitlh
pkiskliedlknkqietrplwkamhtqevfkgakaylngnselffqkgiclpsgtamskd
dvyeisklilksik

Sequence, based on observed residues (ATOM records): (download)

>d1o62b_ c.67.1.4 (B:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]}
gnelkyieevfksgefvnrfeqsvkdysksenalalnsataalhlalrvagvkqddivla
ssftfiasvapicylkakpvfidcdetynidvdllklaikecekkpkalilthlygnaak
mdeiveickendivliedaaealgsfyknkalgtfgefgvysyngnkiittsgggmligk
nkekiekarfystqarenclhyehldygynyrlsnvlgaigvaqmevleqrvlkkreiye
wykeflgeyfsfldelensrsnrwlstalinfdknelnacqkdinisqknitlhpkiskl
iedlknkqietrplwkamhtqevfkgakaylngnselffqkgiclpsgtamskddvyeis
klilksik

SCOPe Domain Coordinates for d1o62b_:

Click to download the PDB-style file with coordinates for d1o62b_.
(The format of our PDB-style files is described here.)

Timeline for d1o62b_: