Lineage for d1o62a_ (1o62 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1866757Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 1866874Protein Aminotransferase homolog WlaK (PglE, Cj1121c) [102603] (1 species)
  7. 1866875Species Campylobacter jejuni [TaxId:197] [102604] (3 PDB entries)
  8. 1866880Domain d1o62a_: 1o62 A: [92538]
    structural genomics
    complexed with act, bme

Details for d1o62a_

PDB Entry: 1o62 (more details), 2.1 Å

PDB Description: crystal structure of the apo form of a plp-dependent enzyme
PDB Compounds: (A:) aminotransferase

SCOPe Domain Sequences for d1o62a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o62a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]}
gnelkyieevfksnyiaplgefvnrfeqsvkdysksenalalnsataalhlalrvagvkq
ddivlassftfiasvapicylkakpvfidcdetynidvdllklaikecekkpkalilthl
ygnaakmdeiveickendivliedaaealgsfyknkalgtfgefgvysyngnkiittsgg
gmligknkekiekarfystqarenclhyehldygynyrlsnvlgaigvaqmevleqrvlk
kreiyewykeflgeyfsfldelensrsnrwlstalinfdknelnacqkdinisqknitlh
pkiskliedlknkqietrplwkamhtqevfkgakaylngnselffqkgiclpsgtamskd
dvyeisklilksik

SCOPe Domain Coordinates for d1o62a_:

Click to download the PDB-style file with coordinates for d1o62a_.
(The format of our PDB-style files is described here.)

Timeline for d1o62a_: