SCOP 1.69: Domain d1o62a_: 1o62 A:

Lineage for d1o62a_ (1o62 A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (6 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (13 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein Aminotransferase homolog WlaK (PglE, Cj1121c) [102603] (1 species)

7. Species Campylobacter jejuni [TaxId:197] [102604] (3 PDB entries)

8. Domain d1o62a_: 1o62 A: [92538]

Details for d1o62a_

PDB Entry: 1o62, 2.1 Å

PDB Description: crystal structure of the apo form of a plp-dependent enzyme

SCOP Domain Sequences for d1o62a_:

Sequence; same for both SEQRES and ATOM records:

>d1o62a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni}
gnelkyieevfksnyiaplgefvnrfeqsvkdysksenalalnsataalhlalrvagvkq
ddivlassftfiasvapicylkakpvfidcdetynidvdllklaikecekkpkalilthl
ygnaakmdeiveickendivliedaaealgsfyknkalgtfgefgvysyngnkiittsgg
gmligknkekiekarfystqarenclhyehldygynyrlsnvlgaigvaqmevleqrvlk
kreiyewykeflgeyfsfldelensrsnrwlstalinfdknelnacqkdinisqknitlh
pkiskliedlknkqietrplwkamhtqevfkgakaylngnselffqkgiclpsgtamskd
dvyeisklilksik

Timeline for d1o62a_:

• d1o62a_ first appeared in SCOP 1.67
  
• d1o62a_ appears in SCOP 1.71
  
• d1o62a_ appears in the current release, SCOPe 2.08