Lineage for d1o60a_ (1o60 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 385592Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 385893Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 385967Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (3 species)
  7. 386009Species Haemophilus influenzae [TaxId:727] [102095] (1 PDB entry)
  8. 386010Domain d1o60a_: 1o60 A: [92532]

Details for d1o60a_

PDB Entry: 1o60 (more details), 1.8 Å

PDB Description: crystal structure of kdo-8-phosphate synthase

SCOP Domain Sequences for d1o60a_:

Sequence, based on SEQRES records: (download)

>d1o60a_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Haemophilus influenzae}
qnkivkignidvandkpfvlfggmnvlesrdmamqvceayvkvteklgvpyvfkasfdka
nrssihsyrgpgmeeglkifqelkdtfgvkiitdvheiyqcqpvadvvdiiqlpaflarq
tdlveamaktgavinvkkpqflspsqmgnivekieecgndkiilcdrgtnfgydnlivdm
lgfsvmkkaskgspvifdvthslqcrdpfgaassgrraqvtelarsglavgiaglfleah
pnpnqakcdgpsalplsalegfvsqmkaiddlvksfpeldt

Sequence, based on observed residues (ATOM records): (download)

>d1o60a_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Haemophilus influenzae}
qnkivkignidvandkpfvlfggmnvlesrdmamqvceayvkvteklgvpyvfkasfdka
nrssihsyrgpgmeeglkifqelkdtfgvkiitdvheiyqcqpvadvvdiiqlpaflarq
tdlveamaktgavinvkkpqflspsqmgnivekieecgndkiilcdrgtnfgydnlivdm
lgfsvmkkaskgspvifdvthslqraqvtelarsglavgiaglfleahpnpnqakcdgps
alplsalegfvsqmkaiddlvksfpeldt

SCOP Domain Coordinates for d1o60a_:

Click to download the PDB-style file with coordinates for d1o60a_.
(The format of our PDB-style files is described here.)

Timeline for d1o60a_: