![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) ![]() has extra strand located between strands 1 and 2 |
![]() | Family c.72.2.2: Folylpolyglutamate synthetase [53629] (1 protein) |
![]() | Protein Folylpolyglutamate synthetase [53630] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [102644] (1 PDB entry) TM0166 |
![]() | Domain d1o5za2: 1o5z A:-2-293 [92531] Other proteins in same PDB: d1o5za1 structural genomics complexed with cl, so4, unl |
PDB Entry: 1o5z (more details), 2.1 Å
SCOPe Domain Sequences for d1o5za2:
Sequence, based on SEQRES records: (download)
>d1o5za2 c.72.2.2 (A:-2-293) Folylpolyglutamate synthetase {Thermotoga maritima [TaxId: 2336]} hhhmaylevlrylyhkrpmgkvkpglerismllsklgnphleyktihiggtngkgsvanm vsnilvsqgyrvgsyysphlstfrerirlneeyiseedvvkiyetmepilneldkeeifs psffevvtamaflyfaeknvdiavlevglggrldatnvvfplcstivtvdrdhektlgyt ieqiaweksgiikervplvtgerkrealkvmedvarkkssrmyvidkdfsvkvkslklhe nrfdycgentfedlvltmngphqienagvalktleatglplsekaireglknaknl
>d1o5za2 c.72.2.2 (A:-2-293) Folylpolyglutamate synthetase {Thermotoga maritima [TaxId: 2336]} hhhmaylevlrylyhkvkpglerismllsklgnphleyktihiggtngkgsvanmvsnil vsqgyrvgsyysphlstfrerirlneeyiseedvvkiyetmepilneldkeeifspsffe vvtamaflyfaeknvdiavlevglggrldatnvvfplcstivtvdrytieqiaweksgii kervplvtgerkrealkvmedvarkkssrmyvidkdfsvkvkslklhenrfdycgentfe dlvltmngphqienagvalktleatglplsekaireglknaknl
Timeline for d1o5za2: