Lineage for d1o5za2 (1o5z A:1-293)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137975Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2138018Family c.72.2.2: Folylpolyglutamate synthetase [53629] (1 protein)
  6. 2138019Protein Folylpolyglutamate synthetase [53630] (2 species)
  7. 2138028Species Thermotoga maritima [TaxId:2336] [102644] (1 PDB entry)
    TM0166
  8. 2138029Domain d1o5za2: 1o5z A:1-293 [92531]
    Other proteins in same PDB: d1o5za1, d1o5za3
    structural genomics
    complexed with cl, so4, unl

Details for d1o5za2

PDB Entry: 1o5z (more details), 2.1 Å

PDB Description: crystal structure of folylpolyglutamate synthase (tm0166) from thermotoga maritima at 2.10 a resolution
PDB Compounds: (A:) folylpolyglutamate synthase/dihydrofolate synthase

SCOPe Domain Sequences for d1o5za2:

Sequence, based on SEQRES records: (download)

>d1o5za2 c.72.2.2 (A:1-293) Folylpolyglutamate synthetase {Thermotoga maritima [TaxId: 2336]}
maylevlrylyhkrpmgkvkpglerismllsklgnphleyktihiggtngkgsvanmvsn
ilvsqgyrvgsyysphlstfrerirlneeyiseedvvkiyetmepilneldkeeifspsf
fevvtamaflyfaeknvdiavlevglggrldatnvvfplcstivtvdrdhektlgytieq
iaweksgiikervplvtgerkrealkvmedvarkkssrmyvidkdfsvkvkslklhenrf
dycgentfedlvltmngphqienagvalktleatglplsekaireglknaknl

Sequence, based on observed residues (ATOM records): (download)

>d1o5za2 c.72.2.2 (A:1-293) Folylpolyglutamate synthetase {Thermotoga maritima [TaxId: 2336]}
maylevlrylyhkvkpglerismllsklgnphleyktihiggtngkgsvanmvsnilvsq
gyrvgsyysphlstfrerirlneeyiseedvvkiyetmepilneldkeeifspsffevvt
amaflyfaeknvdiavlevglggrldatnvvfplcstivtvdrytieqiaweksgiiker
vplvtgerkrealkvmedvarkkssrmyvidkdfsvkvkslklhenrfdycgentfedlv
ltmngphqienagvalktleatglplsekaireglknaknl

SCOPe Domain Coordinates for d1o5za2:

Click to download the PDB-style file with coordinates for d1o5za2.
(The format of our PDB-style files is described here.)

Timeline for d1o5za2: