| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) ![]() |
| Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein) |
| Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species) |
| Species Thermotoga maritima [TaxId:2336] [102532] (1 PDB entry) TM0166 |
| Domain d1o5za1: 1o5z A:294-430 [92530] Other proteins in same PDB: d1o5za2 structural genomics complexed with cl, so4, unl |
PDB Entry: 1o5z (more details), 2.1 Å
SCOP Domain Sequences for d1o5za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o5za1 c.59.1.2 (A:294-430) Folylpolyglutamate synthetase, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
grfeilekngkmyildgahnphgaeslvrslklyfngeplslvigilddknredilrkyt
gifervivtrvpsprmkdmnslvdmakkffknveviedpleaiesteratvvtgslflvg
yvreflttgkineewkl
Timeline for d1o5za1: