SCOP 1.73: Domain d1o5za1: 1o5z A:294-430

Lineage for d1o5za1 (1o5z A:294-430)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families)

5. Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein)

6. Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [102532] (1 PDB entry)
   TM0166

8. Domain d1o5za1: 1o5z A:294-430 [92530]
   Other proteins in same PDB: d1o5za2
   structural genomics
   complexed with cl, so4, unl

Details for d1o5za1

PDB Entry: 1o5z, 2.1 Å

PDB Description: crystal structure of folylpolyglutamate synthase (tm0166) from thermotoga maritima at 2.10 a resolution

PDB Compounds: (A:) folylpolyglutamate synthase/dihydrofolate synthase

SCOP Domain Sequences for d1o5za1:

Sequence; same for both SEQRES and ATOM records:

>d1o5za1 c.59.1.2 (A:294-430) Folylpolyglutamate synthetase, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
grfeilekngkmyildgahnphgaeslvrslklyfngeplslvigilddknredilrkyt
gifervivtrvpsprmkdmnslvdmakkffknveviedpleaiesteratvvtgslflvg
yvreflttgkineewkl

Timeline for d1o5za1:

• d1o5za1 first appeared in SCOP 1.67
  
• d1o5za1 appears in SCOP 1.71
  
• d1o5za1 appears in SCOP 1.75
  
• d1o5za1 appears in the current release, SCOPe 2.08