Lineage for d1o5za1 (1o5z A:294-430)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398850Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 398851Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 398881Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein)
  6. 398882Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species)
  7. 398887Species Thermotoga maritima [TaxId:243274] [102532] (1 PDB entry)
    TM0166
  8. 398888Domain d1o5za1: 1o5z A:294-430 [92530]
    Other proteins in same PDB: d1o5za2
    structural genomics
    complexed with cl, so4, unl

Details for d1o5za1

PDB Entry: 1o5z (more details), 2.1 Å

PDB Description: crystal structure of folylpolyglutamate synthase (tm0166) from thermotoga maritima at 2.10 a resolution

SCOP Domain Sequences for d1o5za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5za1 c.59.1.2 (A:294-430) Folylpolyglutamate synthetase, C-terminal domain {Thermotoga maritima}
grfeilekngkmyildgahnphgaeslvrslklyfngeplslvigilddknredilrkyt
gifervivtrvpsprmkdmnslvdmakkffknveviedpleaiesteratvvtgslflvg
yvreflttgkineewkl

SCOP Domain Coordinates for d1o5za1:

Click to download the PDB-style file with coordinates for d1o5za1.
(The format of our PDB-style files is described here.)

Timeline for d1o5za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o5za2