Lineage for d1o5xb_ (1o5x B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 383643Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 383644Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 383645Protein Triosephosphate isomerase [51353] (16 species)
  7. 383714Species Plasmodium falciparum [51359] (6 PDB entries)
  8. 383716Domain d1o5xb_: 1o5x B: [92529]
    complexed with 2pg, 3py, po3; mutant

Details for d1o5xb_

PDB Entry: 1o5x (more details), 1.1 Å

PDB Description: Plasmodium falciparum TIM complexed to 2-phosphoglycerate
PDB Compounds: (B:)

SCOP Domain Sequences for d1o5xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5xb_ c.1.1.1 (B:) Triosephosphate isomerase {Plasmodium falciparum}
rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
iiksam

SCOP Domain Coordinates for d1o5xb_:

Click to download the PDB-style file with coordinates for d1o5xb_.
(The format of our PDB-style files is described here.)

Timeline for d1o5xb_: