Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
Protein Monoamine oxidase B [69673] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [102801] (14 PDB entries) |
Domain d1o5wd2: 1o5w D:3299-3410 [92527] Other proteins in same PDB: d1o5wa1, d1o5wb1, d1o5wc1, d1o5wd1 complexed with fad, mlg |
PDB Entry: 1o5w (more details), 3.2 Å
SCOP Domain Sequences for d1o5wd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o5wd2 d.16.1.5 (D:3299-3410) Monoamine oxidase B {Rat (Rattus norvegicus) [TaxId: 10116]} pmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarka drlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytay
Timeline for d1o5wd2: