Lineage for d1o5wd2 (1o5w D:3299-3410)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 854919Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 854920Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 855121Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 855155Protein Monoamine oxidase B [69673] (2 species)
  7. 855195Species Rat (Rattus norvegicus) [TaxId:10116] [102801] (14 PDB entries)
  8. 855225Domain d1o5wd2: 1o5w D:3299-3410 [92527]
    Other proteins in same PDB: d1o5wa1, d1o5wb1, d1o5wc1, d1o5wd1
    complexed with fad, mlg

Details for d1o5wd2

PDB Entry: 1o5w (more details), 3.2 Å

PDB Description: The structure basis of specific recognitions for substrates and inhibitors of rat monoamine oxidase A
PDB Compounds: (D:) Amine oxidase [flavin-containing] A

SCOP Domain Sequences for d1o5wd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5wd2 d.16.1.5 (D:3299-3410) Monoamine oxidase B {Rat (Rattus norvegicus) [TaxId: 10116]}
pmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarka
drlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytay

SCOP Domain Coordinates for d1o5wd2:

Click to download the PDB-style file with coordinates for d1o5wd2.
(The format of our PDB-style files is described here.)

Timeline for d1o5wd2: