Lineage for d1o5wd2 (1o5w D:3299-3410)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 500350Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 500351Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 500497Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)
  6. 500517Protein Monoamine oxidase B [69673] (2 species)
  7. 500547Species Rat (Rattus norvegicus) [TaxId:10116] [102801] (1 PDB entry)
  8. 500551Domain d1o5wd2: 1o5w D:3299-3410 [92527]
    Other proteins in same PDB: d1o5wa1, d1o5wb1, d1o5wc1, d1o5wd1

Details for d1o5wd2

PDB Entry: 1o5w (more details), 3.2 Å

PDB Description: The structure basis of specific recognitions for substrates and inhibitors of rat monoamine oxidase A

SCOP Domain Sequences for d1o5wd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5wd2 d.16.1.5 (D:3299-3410) Monoamine oxidase B {Rat (Rattus norvegicus)}
pmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarka
drlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytay

SCOP Domain Coordinates for d1o5wd2:

Click to download the PDB-style file with coordinates for d1o5wd2.
(The format of our PDB-style files is described here.)

Timeline for d1o5wd2: