SCOP 1.67: Domain d1o5wd2: 1o5w D:3299-3410

Lineage for d1o5wd2 (1o5w D:3299-3410)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)

6. Protein Monoamine oxidase B [69673] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [102801] (1 PDB entry)

8. Domain d1o5wd2: 1o5w D:3299-3410 [92527]
   Other proteins in same PDB: d1o5wa1, d1o5wb1, d1o5wc1, d1o5wd1
   complexed with fad, mlg

Details for d1o5wd2

PDB Entry: 1o5w, 3.2 Å

PDB Description: The structure basis of specific recognitions for substrates and inhibitors of rat monoamine oxidase A

SCOP Domain Sequences for d1o5wd2:

Sequence; same for both SEQRES and ATOM records:

>d1o5wd2 d.16.1.5 (D:3299-3410) Monoamine oxidase B {Rat (Rattus norvegicus)}
pmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarka
drlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytay

Timeline for d1o5wd2:

• d1o5wd2 is new in SCOP 1.67
  
• d1o5wd2 appears in SCOP 1.69
  
• d1o5wd2 appears in the current release, SCOPe 2.08