SCOP 1.73: Domain d1o5wc2: 1o5w C:2299-2410

Lineage for d1o5wc2 (1o5w C:2299-2410)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)

6. Protein Monoamine oxidase B [69673] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [102801] (14 PDB entries)

8. Domain d1o5wc2: 1o5w C:2299-2410 [92525]
   Other proteins in same PDB: d1o5wa1, d1o5wb1, d1o5wc1, d1o5wd1

Details for d1o5wc2

PDB Entry: 1o5w, 3.2 Å

PDB Description: The structure basis of specific recognitions for substrates and inhibitors of rat monoamine oxidase A

PDB Compounds: (C:) Amine oxidase [flavin-containing] A

SCOP Domain Sequences for d1o5wc2:

Sequence; same for both SEQRES and ATOM records:

>d1o5wc2 d.16.1.5 (C:2299-2410) Monoamine oxidase B {Rat (Rattus norvegicus) [TaxId: 10116]}
pmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarka
drlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytay

Timeline for d1o5wc2:

• d1o5wc2 first appeared in SCOP 1.67
  
• d1o5wc2 appears in SCOP 1.71
  
• d1o5wc2 appears in SCOP 1.75
  
• d1o5wc2 appears in the current release, SCOPe 2.08