Lineage for d1o5wc1 (1o5w C:2010-2298,C:2411-2521)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2457696Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2457810Protein Monoamine oxidase B [69423] (2 species)
  7. 2457912Species Norway rat (Rattus norvegicus) [TaxId:10116] [102180] (1 PDB entry)
  8. 2457915Domain d1o5wc1: 1o5w C:2010-2298,C:2411-2521 [92524]
    Other proteins in same PDB: d1o5wa2, d1o5wb2, d1o5wc2, d1o5wd2
    complexed with fad

Details for d1o5wc1

PDB Entry: 1o5w (more details), 3.2 Å

PDB Description: The structure basis of specific recognitions for substrates and inhibitors of rat monoamine oxidase A
PDB Compounds: (C:) Amine oxidase [flavin-containing] A

SCOPe Domain Sequences for d1o5wc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5wc1 c.3.1.2 (C:2010-2298,C:2411-2521) Monoamine oxidase B {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aghmfdvvvigggisglaaakllseykinvlvleardrvggrtytvrnehvkwvdvggay
vgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgafppvwnplayldynnlwr
tmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktarefaylfvninvtsephev
salwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimgllgdkvklsspvtyidq
tddniivetlnhehyeckyvisaippiltakihfkpelppernqliqrlXfppgimtqyg
rvirqpvgriyfagtetatqwsgymegaveageraarevlnalgkvakkdiwveepeskd
vpaieithtflernlpsvpgllkitgvstsvallcfvlyki

SCOPe Domain Coordinates for d1o5wc1:

Click to download the PDB-style file with coordinates for d1o5wc1.
(The format of our PDB-style files is described here.)

Timeline for d1o5wc1: