SCOP 1.69: Domain d1o5wc1: 1o5w C:2010-2298,C:2411-2521

Lineage for d1o5wc1 (1o5w C:2010-2298,C:2411-2521)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (13 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Monoamine oxidase B [69423] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [102180] (1 PDB entry)

8. Domain d1o5wc1: 1o5w C:2010-2298,C:2411-2521 [92524]
   Other proteins in same PDB: d1o5wa2, d1o5wb2, d1o5wc2, d1o5wd2

Details for d1o5wc1

PDB Entry: 1o5w, 3.2 Å

PDB Description: The structure basis of specific recognitions for substrates and inhibitors of rat monoamine oxidase A

SCOP Domain Sequences for d1o5wc1:

Sequence; same for both SEQRES and ATOM records:

>d1o5wc1 c.3.1.2 (C:2010-2298,C:2411-2521) Monoamine oxidase B {Rat (Rattus norvegicus)}
aghmfdvvvigggisglaaakllseykinvlvleardrvggrtytvrnehvkwvdvggay
vgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgafppvwnplayldynnlwr
tmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktarefaylfvninvtsephev
salwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimgllgdkvklsspvtyidq
tddniivetlnhehyeckyvisaippiltakihfkpelppernqliqrlXfppgimtqyg
rvirqpvgriyfagtetatqwsgymegaveageraarevlnalgkvakkdiwveepeskd
vpaieithtflernlpsvpgllkitgvstsvallcfvlyki

Timeline for d1o5wc1:

• d1o5wc1 first appeared in SCOP 1.67
  
• d1o5wc1 appears in SCOP 1.71
  
• d1o5wc1 appears in the current release, SCOPe 2.08