![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
![]() | Protein Monoamine oxidase B [69673] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [102801] (1 PDB entry) |
![]() | Domain d1o5wb2: 1o5w B:1299-1410 [92523] Other proteins in same PDB: d1o5wa1, d1o5wb1, d1o5wc1, d1o5wd1 complexed with fad |
PDB Entry: 1o5w (more details), 3.2 Å
SCOPe Domain Sequences for d1o5wb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o5wb2 d.16.1.5 (B:1299-1410) Monoamine oxidase B {Norway rat (Rattus norvegicus) [TaxId: 10116]} pmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarka drlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytay
Timeline for d1o5wb2: