Lineage for d1o5wb2 (1o5w B:1299-1410)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. Protein Monoamine oxidase B [69673] (2 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [102801] (1 PDB entry)
  8. Domain d1o5wb2: 1o5w B:1299-1410 [92523]
    Other proteins in same PDB: d1o5wa1, d1o5wb1, d1o5wc1, d1o5wd1
    complexed with fad

Details for d1o5wb2

PDB Entry: 1o5w (more details), 3.2 Å

PDB Description: The structure basis of specific recognitions for substrates and inhibitors of rat monoamine oxidase A
PDB Compounds: (B:) Amine oxidase [flavin-containing] A

SCOPe Domain Sequences for d1o5wb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5wb2 d.16.1.5 (B:1299-1410) Monoamine oxidase B {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarka
drlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytay

SCOPe Domain Coordinates for d1o5wb2 are not available.

Timeline for d1o5wb2:

Domains from same chain:
(mouse over for more information)
d1o5wb1
Domains from other chains:
(mouse over for more information)
d1o5wa1, d1o5wa2, d1o5wc1, d1o5wc2, d1o5wd1, d1o5wd2