Lineage for d1o5wa2 (1o5w A:299-410)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 408639Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 408640Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 408786Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)
  6. 408803Protein Monoamine oxidase B [69673] (2 species)
  7. 408833Species Rat (Rattus norvegicus) [TaxId:10116] [102801] (1 PDB entry)
  8. 408834Domain d1o5wa2: 1o5w A:299-410 [92521]
    Other proteins in same PDB: d1o5wa1, d1o5wb1, d1o5wc1, d1o5wd1

Details for d1o5wa2

PDB Entry: 1o5w (more details), 3.2 Å

PDB Description: The structure basis of specific recognitions for substrates and inhibitors of rat monoamine oxidase A

SCOP Domain Sequences for d1o5wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5wa2 d.16.1.5 (A:299-410) Monoamine oxidase B {Rat (Rattus norvegicus)}
pmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarka
drlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytay

SCOP Domain Coordinates for d1o5wa2:

Click to download the PDB-style file with coordinates for d1o5wa2.
(The format of our PDB-style files is described here.)

Timeline for d1o5wa2: