Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.8: Hypothetical protein TM1112 [89406] (1 protein) |
Protein Hypothetical protein TM1112 [89407] (1 species) |
Species Thermotoga maritima [TaxId:2336] [89408] (3 PDB entries) |
Domain d1o5ub_: 1o5u B: [92519] structural genomics complexed with unl |
PDB Entry: 1o5u (more details), 1.83 Å
SCOPe Domain Sequences for d1o5ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o5ub_ b.82.1.8 (B:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} evkiekptpeklkelsvekwpiwekevsefdwyydtnetcyilegkvevttedgkkyvie kgdlvtfpkglrcrwkvlepvrkhynlf
Timeline for d1o5ub_: