SCOPe 2.06: Domain d1o5ub_: 1o5u B:

Lineage for d1o5ub_ (1o5u B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.8: Hypothetical protein TM1112 [89406] (1 protein)

6. Protein Hypothetical protein TM1112 [89407] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [89408] (3 PDB entries)

8. Domain d1o5ub_: 1o5u B: [92519]
   structural genomics
   complexed with unl

Details for d1o5ub_

PDB Entry: 1o5u, 1.83 Å

PDB Description: crystal structure of a duf861 family protein (tm1112) from thermotoga maritima at 1.83 a resolution

PDB Compounds: (B:) novel Thermotoga maritima enzyme TM1112

SCOPe Domain Sequences for d1o5ub_:

Sequence; same for both SEQRES and ATOM records:

>d1o5ub_ b.82.1.8 (B:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]}
evkiekptpeklkelsvekwpiwekevsefdwyydtnetcyilegkvevttedgkkyvie
kgdlvtfpkglrcrwkvlepvrkhynlf

Timeline for d1o5ub_:

• d1o5ub_ first appeared in SCOP 1.67
  
• d1o5ub_ appears in SCOPe 2.05
  
• d1o5ub_ appears in SCOPe 2.07
  
• d1o5ub_ appears in the current release, SCOPe 2.08