Lineage for d1o5qa_ (1o5q A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475982Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 476105Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (3 proteins)
    forms a swapped dimer
  6. 476106Protein 2-methylisocitrate lyase [89499] (2 species)
  7. 476112Species Salmonella typhimurium [TaxId:90371] [102099] (2 PDB entries)
  8. 476117Domain d1o5qa_: 1o5q A: [92514]

Details for d1o5qa_

PDB Entry: 1o5q (more details), 2.3 Å

PDB Description: Crystal Structure of Pyruvate and Mg2+ bound 2-methylisocitrate lyase (PrpB) from Salmonella typhimurium

SCOP Domain Sequences for d1o5qa_:

Sequence, based on SEQRES records: (download)

>d1o5qa_ c.1.12.7 (A:) 2-methylisocitrate lyase {Salmonella typhimurium}
spgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgistl
ddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvgakrcg
hrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayvdagadm
lfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframn
raaekvytvlrqegtqknvidimqtrnelyesinyyqfeekl

Sequence, based on observed residues (ATOM records): (download)

>d1o5qa_ c.1.12.7 (A:) 2-methylisocitrate lyase {Salmonella typhimurium}
spgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgistl
ddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivske
emvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitelsm
yrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvlr
qegtqknvidimqtrnelyesinyyqfeekl

SCOP Domain Coordinates for d1o5qa_:

Click to download the PDB-style file with coordinates for d1o5qa_.
(The format of our PDB-style files is described here.)

Timeline for d1o5qa_: