Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.7: Actinoxanthin-like [49319] (1 family) |
Family b.1.7.1: Actinoxanthin-like [49320] (5 proteins) |
Protein Neocarzinostatin [49323] (1 species) |
Species Streptomyces carzinostaticus [TaxId:1897] [49324] (7 PDB entries) |
Domain d1o5pa_: 1o5p A: [92513] complexed with chr |
PDB Entry: 1o5p (more details)
SCOP Domain Sequences for d1o5pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o5pa_ b.1.7.1 (A:) Neocarzinostatin {Streptomyces carzinostaticus [TaxId: 1897]} aaptatvtpssglsdgtvvkvagaglqagtaydvgqcawvdtgvlacnpadfssvtadan gsastsltvrrsfegflfdgtrwgtvdcttaacqvglsdaagngpegvaisfn
Timeline for d1o5pa_: