Lineage for d1o5od_ (1o5o D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398986Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 398987Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 398988Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (10 proteins)
  6. 399116Protein Uracil PRTase [53293] (5 species)
  7. 399124Species Thermotoga maritima [TaxId:243274] [102538] (1 PDB entry)
    TM0721
  8. 399128Domain d1o5od_: 1o5o D: [92512]
    structural genomics
    complexed with so4, u5p

Details for d1o5od_

PDB Entry: 1o5o (more details), 2.3 Å

PDB Description: crystal structure of uracil phosphoribosyltransferase (tm0721) from thermotoga maritima at 2.30 a resolution

SCOP Domain Sequences for d1o5od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5od_ c.61.1.1 (D:) Uracil PRTase {Thermotoga maritima}
hmknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhlkceevevetpi
tktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpetlqaveyyaklp
plnddkevflldpmlatgvssikaieilkengakkitlvaliaapegveavekkyedvki
yvaalderlndhgyiipglgdagdrlfrtk

SCOP Domain Coordinates for d1o5od_:

Click to download the PDB-style file with coordinates for d1o5od_.
(The format of our PDB-style files is described here.)

Timeline for d1o5od_: