Lineage for d1o5ob_ (1o5o B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128512Protein Uracil PRTase, Upp [53293] (5 species)
  7. 2128542Species Thermotoga maritima [TaxId:2336] [102538] (1 PDB entry)
    TM0721
  8. 2128544Domain d1o5ob_: 1o5o B: [92510]
    Other proteins in same PDB: d1o5oa2, d1o5oc2, d1o5od2
    structural genomics
    complexed with so4, u5p

Details for d1o5ob_

PDB Entry: 1o5o (more details), 2.3 Å

PDB Description: Crystal structure of Uracil phosphoribosyltransferase (TM0721) from Thermotoga maritima at 2.30 A resolution
PDB Compounds: (B:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1o5ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5ob_ c.61.1.1 (B:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]}
mknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhlkceevevetpit
ktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpetlqaveyyaklpp
lnddkevflldpmlatgvssikaieilkengakkitlvaliaapegveavekkyedvkiy
vaalderlndhgyiipglgdagdrlfrtk

SCOPe Domain Coordinates for d1o5ob_:

Click to download the PDB-style file with coordinates for d1o5ob_.
(The format of our PDB-style files is described here.)

Timeline for d1o5ob_: