Lineage for d1o5oa_ (1o5o A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863464Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1863465Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1863466Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 1863717Protein Uracil PRTase, Upp [53293] (5 species)
  7. 1863747Species Thermotoga maritima [TaxId:2336] [102538] (1 PDB entry)
    TM0721
  8. 1863748Domain d1o5oa_: 1o5o A: [92509]
    structural genomics
    complexed with so4, u5p

Details for d1o5oa_

PDB Entry: 1o5o (more details), 2.3 Å

PDB Description: crystal structure of uracil phosphoribosyltransferase (tm0721) from thermotoga maritima at 2.30 a resolution
PDB Compounds: (A:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1o5oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]}
hmknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhlkceevevetpi
tktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpetlqaveyyaklp
plnddkevflldpmlatgvssikaieilkengakkitlvaliaapegveavekkyedvki
yvaalderlndhgyiipglgdagdrlfrtk

SCOPe Domain Coordinates for d1o5oa_:

Click to download the PDB-style file with coordinates for d1o5oa_.
(The format of our PDB-style files is described here.)

Timeline for d1o5oa_: