Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein CRP-like transcriptional regulator TM1171, N-terminal domain [101991] (1 species) |
Species Thermotoga maritima [TaxId:2336] [101992] (1 PDB entry) |
Domain d1o5la1: 1o5l A:1-129 [92506] structural genomics DNA-binding domain (res. 130-213) is disordered in this structure |
PDB Entry: 1o5l (more details), 2.3 Å
SCOPe Domain Sequences for d1o5la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} mdlkkllpcgkvivfrkgeivkhqddpiedvlillegtlktehvsengktleideikpvq iiasgfifsseprfpvnvvagenskilsipkevfldllmkdrelllfflkdvsehfrvvs eklfflttk
Timeline for d1o5la1: