SCOPe 2.04: Domain d1o5la1: 1o5l A:1-129

Lineage for d1o5la1 (1o5l A:1-129)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein CRP-like transcriptional regulator TM1171, N-terminal domain [101991] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101992] (1 PDB entry)

8. Domain d1o5la1: 1o5l A:1-129 [92506]
   structural genomics
   DNA-binding domain (res. 130-213) is disordered in this structure

Details for d1o5la1

PDB Entry: 1o5l, 2.3 Å

PDB Description: crystal structure of transcriptional regulator (tm1171) from thermotoga maritima at 2.30 a resolution

PDB Compounds: (A:) transcriptional regulator, crp family

SCOPe Domain Sequences for d1o5la1:

Sequence; same for both SEQRES and ATOM records:

>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mdlkkllpcgkvivfrkgeivkhqddpiedvlillegtlktehvsengktleideikpvq
iiasgfifsseprfpvnvvagenskilsipkevfldllmkdrelllfflkdvsehfrvvs
eklfflttk

Timeline for d1o5la1:

• d1o5la1 first appeared in SCOP 1.67
  
• d1o5la1 appears in SCOPe 2.03
  
• d1o5la1 appears in SCOPe 2.05
  
• d1o5la1 appears in the current release, SCOPe 2.08