Lineage for d1o5ka1 (1o5k A:1-294)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2096923Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2097054Protein Dihydrodipicolinate synthase [51574] (13 species)
  7. 2097153Species Thermotoga maritima [TaxId:2336] [102090] (1 PDB entry)
  8. 2097154Domain d1o5ka1: 1o5k A:1-294 [92504]
    Other proteins in same PDB: d1o5ka2, d1o5kb2
    structural genomics
    complexed with ca

Details for d1o5ka1

PDB Entry: 1o5k (more details), 1.8 Å

PDB Description: crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d1o5ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5ka1 c.1.10.1 (A:1-294) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]}
mfrgvgtaivtpfkngeldlesyerlvryqlengvnalivlgttgesptvnedereklvs
rtleivdgkipvivgagtnstektlklvkqaeklgangvlvvtpyynkptqeglyqhyky
isertdlgivvynvpgrtgvnvlpetaariaadlknvvgikeanpdidqidrtvsltkqa
rsdfmvwsgnddrtfyllcaggdgvisvvsnvapkqmvelcaeyfsgnleksrevhrklr
plmkalfvetnpipvkaalnlmgfienelrlplvpasektvellrnvlkesgll

SCOPe Domain Coordinates for d1o5ka1:

Click to download the PDB-style file with coordinates for d1o5ka1.
(The format of our PDB-style files is described here.)

Timeline for d1o5ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o5ka2