Lineage for d1o5ka_ (1o5k A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.10: Aldolase [51569] (9 families) 
Common fold covers whole protein structureFamily c.1.10.1: Class I aldolase [51570] (13 proteins)
the catalytic lysine forms schiff-base intermediate with substrate
possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
Protein Dihydrodipicolinate synthase [51574] (12 species) 
Species Thermotoga maritima [TaxId:2336] [102090] (1 PDB entry) 
Domain d1o5ka_: 1o5k A: [92504]
structural genomics
complexed with ca
Details for d1o5ka_
PDB Entry: 1o5k (more details), 1.8 Å
PDB Description: crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
PDB Compounds: (A:) Dihydrodipicolinate synthaseSCOPe Domain Sequences for d1o5ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]}
hmfrgvgtaivtpfkngeldlesyerlvryqlengvnalivlgttgesptvnedereklv
srtleivdgkipvivgagtnstektlklvkqaeklgangvlvvtpyynkptqeglyqhyk
yisertdlgivvynvpgrtgvnvlpetaariaadlknvvgikeanpdidqidrtvsltkq
arsdfmvwsgnddrtfyllcaggdgvisvvsnvapkqmvelcaeyfsgnleksrevhrkl
rplmkalfvetnpipvkaalnlmgfienelrlplvpasektvellrnvlkesgll
SCOPe Domain Coordinates for d1o5ka_:
Click to download the PDB-style file with coordinates for d1o5ka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o5ka_:
- d1o5ka_ first appeared in SCOP 1.67
- d1o5ka_ appears in SCOPe 2.04
- d1o5ka_ is called d1o5ka1 in SCOPe 2.06
- d1o5ka_ appears in the current release, SCOPe 2.08, called d1o5ka1
View in 3D
