SCOP 1.67: Domain d1o5ka_: 1o5k A:

Lineage for d1o5ka_ (1o5k A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (5 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (10 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Dihydrodipicolinate synthase [51574] (2 species)

7. Species Thermotoga maritima [TaxId:243274] [102090] (1 PDB entry)

8. Domain d1o5ka_: 1o5k A: [92504]

Details for d1o5ka_

PDB Entry: 1o5k, 1.8 Å

PDB Description: crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution

SCOP Domain Sequences for d1o5ka_:

Sequence; same for both SEQRES and ATOM records:

>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima}
hmfrgvgtaivtpfkngeldlesyerlvryqlengvnalivlgttgesptvnedereklv
srtleivdgkipvivgagtnstektlklvkqaeklgangvlvvtpyynkptqeglyqhyk
yisertdlgivvynvpgrtgvnvlpetaariaadlknvvgikeanpdidqidrtvsltkq
arsdfmvwsgnddrtfyllcaggdgvisvvsnvapkqmvelcaeyfsgnleksrevhrkl
rplmkalfvetnpipvkaalnlmgfienelrlplvpasektvellrnvlkesgll

Timeline for d1o5ka_:

• d1o5ka_ is new in SCOP 1.67
  
• d1o5ka_ appears in SCOP 1.69
  
• d1o5ka_ appears in the current release, SCOPe 2.08, called d1o5ka1